TF Information

nRc.2.0.1.g10725 *(Romanomermis culicivorax)* CSD
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source
PF00313 (CSD)	IPR002059	nRc.2.0.1.g10725	T165863_2.00	WormBase:ParaSite (2015-Oct-22)
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
cey-1 M01903_2.00	Caenorhabditis elegans	NNNGRTRDD	HHYAYCNNN	PBM Weirauch et al.(2014) pTH8991	0.818	0.818
YBX1 M04661_2.00	Homo sapiens	GRTGGWACR	YGTWCCAYC	SELEX Yin et al.(2017) YBX1_eDBD_HT-SELEX	0.788	0.788
YBX1 M10411_2.00	Homo sapiens	Transfac license required	Transfac license required	Transfac Matys et al.(2006) V$YB1_Q3	0.788	0.788
YBX1 M10412_2.00	Homo sapiens	Transfac license required	Transfac license required	Transfac Matys et al.(2006) V$YB1_Q4	0.788	0.788
YBX1 M04662_2.00	Homo sapiens	GRTGKDRCD	HGYHMCAYC	SELEX Yin et al.(2017) YBX1_eDBD_Methyl-HT-SELEX	0.788	0.788
NEMVEDRAFT_v1g104083 M01207_2.00	Nematostella vectensis	NNNDDHRN	NYDHHNNN	PBM Lambert et al.(2019) pTH9768	0.773	0.773
Smp_097750 M01208_2.00	Schistosoma mansoni	TAGATAGA	TCTATCTA	PBM Lambert et al.(2019) pTH7807	0.712	0.712
For this family, TFs with SR scores > 0.700* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
nRc.2.0.1.t10725-RA	CSD	59	128	VRGKVKWFNVKNGYGFINRLDKDEDIFVHQTAITKNNPNKYLRSLGDEEEVEFDIVEGQKGPEAANVTGP

Links
Other CSD family TFs
Other *Romanomermis culicivorax* TFs

Invalid Input OrderBy

348 Related TFs

Name	Species	Gene ID	Motif Evidence	SR Score	Action