TF Information

FQ377654.1 *(Danio rerio)* CxxC
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source	Animal TF db
PF02008 (zf-CXXC)	IPR002857	ENSDARG00000098299	T167924_2.00	Ensembl (2018-Dec-8)	Link out
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
XP_006525770.1 M01918_2.00	Mus musculus	CGCGCGWT	AWCGCGCG	PBM Weirauch et al.(2014) pTH7030	0.707	0.707
BAD93120.1_CONSTRUCT M01919_2.00	PBM CONSTRUCTS	NNNBCGN	NCGVNNN	PBM Weirauch et al.(2014) pTH7032	0.707	0.707
CXXC1 M10428_2.00	Homo sapiens	Transfac license required	Transfac license required	Transfac Matys et al.(2006) V$CGBP_01	0.707	0.707
CXXC1 M10429_2.00	Homo sapiens	Transfac license required	Transfac license required	Transfac Matys et al.(2006) V$CGBP_02	0.707	0.707
For this family, TFs with SR scores > 0.700* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
ENSDARP00000140536	CxxC	1	41	MCQRCDACRRDTDCGKCDFCMDKPKFGGSNKKRQKCRLRQC

Links
Other CxxC family TFs
Other *Danio rerio* TFs

Invalid Input OrderBy

50 Related TFs

Name	Species	Gene ID	Motif Evidence	SR Score	Action