TF Information

EBF2 *(Homo sapiens)* EBF1
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source	Animal TF db
PF16422 (COE1_DBD)	(none)	ENSG00000221818	T174554_2.00	Ensembl (2018-Dec-8)	Link out
NCBI Gene Info: The protein encoded by this gene belongs to the COE (Collier/Olf/EBF) family of non-basic, helix-loop-helix transcription factors that have a well conserved DNA binding domain. The COE family proteins play an important role in variety of developmental processes. Studies in mouse suggest that this gene may be involved in the differentiation of osteoblasts. [provided by RefSeq, Oct 2011]
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
EBF2 M10466_2.00	Homo sapiens	Transfac license required	Transfac license required	Transfac Matys et al.(2006) V$COE2_02	(Direct)	(Direct)
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
Ebf2 M10467_2.00	Mus musculus	Transfac license required	Transfac license required	Transfac Matys et al.(2006) V$COE2_01	1.000	1.000
EBF3 M10461_2.00	Homo sapiens	Transfac license required	Transfac license required	Transfac Matys et al.(2006) V$EBF_Q6	0.887	0.887
Ebf1 M09045_2.00	Mus musculus	DBYCCCWRGGGAV	BTCCCYWGGGRVH	Misc Kulakovskiy et al.(2013) COE1_MOUSE.H11MO.0.A	0.959	0.959
Ebf1 M09527_2.00	Mus musculus	DBTCCCHDGGGA	TCCCHDGGGAVH	Misc Heinz et al.(2010) proBcell-EBF_GSE21978	0.959	0.959
Ebf1 M10469_2.00	Mus musculus	VYMHVYYCYYBRGGGAVTHKHB	VDMDABTCCCYVRRGRRBDKRB	Transfac Matys et al.(2006) V$OLF1_01	0.857	0.857
EBF4 M10460_2.00	Homo sapiens	Transfac license required	Transfac license required	Transfac Matys et al.(2006) V$EBF4_02	0.827	0.827
Ebf4 M10468_2.00	Mus musculus	Transfac license required	Transfac license required	Transfac Matys et al.(2006) V$EBF4_01	0.939	0.939
kn M03721_2.00	Drosophila melanogaster	BWATTCCCHDGGGAATWV	BWATTCCCHDGGGAATWV	SELEX Nitta et al.(2015) kn_1	0.727	0.727
For this family, TFs with SR scores > 0.700* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
ENSP00000386178	EBF1	1	98	MCRVLLTHEVMCSRCCEKKSCGNRNETPSDPVIIDRFFLKFFLKCNQNCLKTAGNPRDMRRFQVVLSTTVNVDGHVLAVSDNMFVHNNSKHGRRARRL
ENSP00000430241	EBF1	16	246	EKSLGAEMDSVRSWVRNVGVVDANVAAQSGVALSRAHFEKQPPSNLRKSNFFHFVLALYDRQGQPVEIERTAFVDFVENDKEQGNEKTNNGTHYKLQLLYSNGVRTEQDLYVRLIDSVTKQPIAYEGQNKNPEMCRVLLTHEVMCSRCCEKKSCGNRNETPSDPVIIDRFFLKFFLKCNQNCLKTAGNPRDMRRFQVVLSTTVNVDGHVLAVSDNMFVHNNSKHGRRARRL

Links
Other EBF1 family TFs
Other *Homo sapiens* TFs

Invalid Input OrderBy

367 Related TFs

Name	Species	Gene ID	Motif Evidence	SR Score	Action