TF Information

EBF1 *(Microcebus murinus)* EBF1
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source	Animal TF db
PF16422 (COE1_DBD)	(none)	ENSMICG00000010036	T174594_2.00	Ensembl (2018-Dec-8)	Link out
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
Ebf1 M09045_2.00	Mus musculus	DBYCCCWRGGGAV	BTCCCYWGGGRVH	Misc Kulakovskiy et al.(2013) COE1_MOUSE.H11MO.0.A	0.995	0.995
Ebf1 M09527_2.00	Mus musculus	DBTCCCHDGGGA	TCCCHDGGGAVH	Misc Heinz et al.(2010) proBcell-EBF_GSE21978	0.995	0.995
Ebf1 M10469_2.00	Mus musculus	VYMHVYYCYYBRGGGAVTHKHB	VDMDABTCCCYVRRGRRBDKRB	Transfac Matys et al.(2006) V$OLF1_01	0.995	0.995
EBF3 M10461_2.00	Homo sapiens	Transfac license required	Transfac license required	Transfac Matys et al.(2006) V$EBF_Q6	0.965	0.965
Ebf4 M10468_2.00	Mus musculus	Transfac license required	Transfac license required	Transfac Matys et al.(2006) V$EBF4_01	0.906	0.906
EBF4 M10460_2.00	Homo sapiens	Transfac license required	Transfac license required	Transfac Matys et al.(2006) V$EBF4_02	0.906	0.906
Ebf2 M10467_2.00	Mus musculus	Transfac license required	Transfac license required	Transfac Matys et al.(2006) V$COE2_01	0.896	0.896
kn M03721_2.00	Drosophila melanogaster	BWATTCCCHDGGGAATWV	BWATTCCCHDGGGAATWV	SELEX Nitta et al.(2015) kn_1	0.842	0.842
For this family, TFs with SR scores > 0.700* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
ENSMICP00000009141	EBF1	1	202	GVGLARAHFEKQPPSNLRKSNFFHFVLALYDRQGQPVEIERTAFVGFVGKEKEANSEKTNNGIHYRLQLLYSNGIRTEQDFYVRLIDSMTKQAIVYEGQDKNPEMCRVLLTHEIMCSRCCDKKSCGNRNETPSDPVIIDRFFLKFFLKCNQNCLKNAGNPRDMRRFQVVVSTTVNVDGHVLAVSDNMFVHNNSKHGRRARRL

Links
Other EBF1 family TFs
Other *Microcebus murinus* TFs

Invalid Input OrderBy

308 Related TFs

Name	Species	Gene ID	Motif Evidence	SR Score	Action