TF Information

Ogr13832 *(Ophisaurus gracilis)* EBF1
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source
PF16422 (COE1_DBD)	(none)	Ogr13832	T174831_2.00	GigaDB (2015-Oct-22)
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
EBF3 M10461_2.00	Homo sapiens	Transfac license required	Transfac license required	Transfac Matys et al.(2006) V$EBF_Q6	0.923	0.923
Ebf1 M09045_2.00	Mus musculus	DBYCCCWRGGGAV	BTCCCYWGGGRVH	Misc Kulakovskiy et al.(2013) COE1_MOUSE.H11MO.0.A	0.863	0.863
Ebf1 M09527_2.00	Mus musculus	DBTCCCHDGGGA	TCCCHDGGGAVH	Misc Heinz et al.(2010) proBcell-EBF_GSE21978	0.863	0.863
Ebf1 M10469_2.00	Mus musculus	VYMHVYYCYYBRGGGAVTHKHB	VDMDABTCCCYVRRGRRBDKRB	Transfac Matys et al.(2006) V$OLF1_01	0.863	0.863
Ebf2 M10467_2.00	Mus musculus	Transfac license required	Transfac license required	Transfac Matys et al.(2006) V$COE2_01	0.798	0.798
Ebf4 M10468_2.00	Mus musculus	Transfac license required	Transfac license required	Transfac Matys et al.(2006) V$EBF4_01	0.787	0.787
EBF4 M10460_2.00	Homo sapiens	Transfac license required	Transfac license required	Transfac Matys et al.(2006) V$EBF4_02	0.787	0.787
For this family, TFs with SR scores > 0.700* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
Ogr13832	EBF1	3	187	EEPLGSGMNPVRSWMHTAGVVDANTAAQSGVGLARAHFEKQPPSNLRKSNFFHFVLALYDRQGQPVEIERTAFVDFVEKDKEPNNEKTNNGIHYKLQLLYSNGVRTEQDLYVRLIDSMTKQAIVYEGQDKNPEMCRVLLTHEIMCSRCCDKKSCGNRNETPSDPVIIDRYGNVLGILITAYIKNI

Links
Other EBF1 family TFs
Other *Ophisaurus gracilis* TFs

Invalid Input OrderBy

105 Related TFs

Name	Species	Gene ID	Motif Evidence	SR Score	Action