TF Information

F775_17920 *(Aegilops tauschii)* EIN3
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source	Animal TF db
PF04873 (EIN3)	IPR006957	F775_17920	T175041_2.00	Ensembl (2018-Dec-8)	Link out
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
OS09G0490200 M01970_2.00	Oryza sativa	NMGRTACATNN	NNATGTAYCKN	PBM Weirauch et al.(2014) pTH9013	0.867	0.867
EIL3 M00723_2.00	Arabidopsis thaliana	NAGRTWCATNN	NNATGWAYCTN	PBM Chang et al.(2013) pTH7933	0.739	0.739
EIL3 M06877_2.00	Arabidopsis thaliana	NYGTCYAGRTWCAWDNWHNHH	DDNDWNHWTGWAYCTRGACRN	Dap-seq OMalley et al.(2016) EIL3_col_b	0.739	0.739
For this family, TFs with SR scores > 0.700* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
EMT14735	EIN3	35	285	EELARRMWKDRVRLRRIKERQQRLALQQAELELEKSKPKQISDQAMRKKMARAHDGILKYMLKLMEVCNARGFVYGIIPEKGKPVSGASDNIRAWWKEKVKFDKNGPAAIAKYEAEHLVDADAQSSVVKNEHSLMDLQDATLGSLLSSLMQHCNPPQRKYPLEKGTPPPWWPAGNEEWWAALGLPRGQIAPYKKPHDLKKVWKVGVLTCVIKHMSPNFDKIRNHVRKSKILQDKMTAKESLIWLGVLQREE

Links
Other EIN3 family TFs
Other *Aegilops tauschii* TFs

Invalid Input OrderBy

99 Related TFs

Name	Species	Gene ID	Motif Evidence	SR Score	Action