TF Information

gene00392-v1.0-hybrid *(Fragaria vesca)* EIN3
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source
PF04873 (EIN3)	IPR006957	gene00392-v1.0-hybrid	T175350_2.00	JGI:Phytozome (2018-Apr-12)
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
EIL1 M00724_2.00	Arabidopsis thaliana	NNVRTDMRN	NYKHAYBNN	PBM Chang et al.(2013) pTH7932	0.832	0.832
Q9ZWK1_TOBAC M10470_2.00	Nicotiana tabacum	AGRTWCAT	ATGWAYCT	Transfac Matys et al.(2006) P$TEIL_01	0.832	0.832
EIN3 M00725_2.00	Arabidopsis thaliana	NNRTDHAYNN	NNRTDHAYNN	PBM Chang et al.(2013) pTH8729	0.804	0.804
EIN3 M06878_2.00	Arabidopsis thaliana	GDMYANRTWCAWTGH	DCAWTGWAYNTRKHC	Dap-seq OMalley et al.(2016) EIN3_col_a	0.804	0.804
EIN3 M06879_2.00	Arabidopsis thaliana	RCCGTTR	YAACGGY	Dap-seq OMalley et al.(2016) EIN3_colamp_a	0.804	0.804
e_gw1.87.73.1 M00726_2.00	Physcomitrella patens	NNNRTDCDBN	NVHGHAYNNN	PBM Chang et al.(2013) pTH8479	0.785	0.785
EIL3 M00723_2.00	Arabidopsis thaliana	NAGRTWCATNN	NNATGWAYCTN	PBM Chang et al.(2013) pTH7933	0.729	0.729
EIL3 M06877_2.00	Arabidopsis thaliana	NYGTCYAGRTWCAWDNWHNHH	DDNDWNHWTGWAYCTRGACRN	Dap-seq OMalley et al.(2016) EIL3_col_b	0.729	0.729
For this family, TFs with SR scores > 0.700* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
mrna00392.1-v1.0-hybrid	EIN3	42	148	TFVILMQHCDPPQRCFPLEKGVSPPWWPTGNEEWWPQLNLAKDQGPPYRKPHDLKKAWKVSVLAAMIKHMSPDINKICKLVCQSKCLQDRMTAKESATWLAIINQEE

Links
Other EIN3 family TFs
Other *Fragaria vesca* TFs

Invalid Input OrderBy

33 Related TFs

Name	Species	Gene ID	Motif Evidence	SR Score	Action