TF Information

Thhalv10018327m.g *(Eutrema salsugineum)* EIN3
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source
PF04873 (EIN3)	IPR006957	Thhalv10018327m.g	T175412_2.00	JGI:Phytozome (2018-Apr-12)
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
EIL3 M00723_2.00	Arabidopsis thaliana	NAGRTWCATNN	NNATGWAYCTN	PBM Chang et al.(2013) pTH7933	0.980	0.980
EIL3 M06877_2.00	Arabidopsis thaliana	NYGTCYAGRTWCAWDNWHNHH	DDNDWNHWTGWAYCTRGACRN	Dap-seq OMalley et al.(2016) EIL3_col_b	0.980	0.980
OS09G0490200 M01970_2.00	Oryza sativa	NMGRTACATNN	NNATGTAYCKN	PBM Weirauch et al.(2014) pTH9013	0.768	0.768
e_gw1.87.73.1 M00726_2.00	Physcomitrella patens	NNNRTDCDBN	NVHGHAYNNN	PBM Chang et al.(2013) pTH8479	0.732	0.732
Q9ZWK1_TOBAC M10470_2.00	Nicotiana tabacum	AGRTWCAT	ATGWAYCT	Transfac Matys et al.(2006) P$TEIL_01	0.703	0.703
For this family, TFs with SR scores > 0.700* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
Thhalv10018327m	EIN3	38	283	EDLERRMWKDRVRLKRIKERQKGGSQGAQTKEMPKKISDQAQRKKMSRAQDGILKYMLKLMEVCKVRGFVYGIIPEKGKPVSGSSDNIRAWWKEKVKFDKNGPAAIAKYEEECLAFGKSDGNRNSQFVLQDLQDATLGSLLSSLMQHCDPPQRKYPLEKGTPPPWWPTGDEEWWVKLGLPKSQSPPYRKPHDLKKMWKVGVLTAVINHMSPDIAKIKRHVRQSKCLQDKMTAKESAIWLAVLNQEE

Links
Other EIN3 family TFs
Other *Eutrema salsugineum* TFs

Invalid Input OrderBy

120 Related TFs

Name	Species	Gene ID	Motif Evidence	SR Score	Action