TF Information

POPTR_0006s02140 *(Populus trichocarpa)* FAR1
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source	Animal TF db
PF03101 (FAR1)	IPR004330	POPTR_0006s02140	T180081_2.00	Ensembl (2018-Dec-8)	Link out
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
FAR1 M06880_2.00	Arabidopsis thaliana	NNYHCACGCGCYDNH	DNHRGCGCGTGDRNN	Dap-seq OMalley et al.(2016) FAR1_col_a	0.909	0.909
FAR1 M06881_2.00	Arabidopsis thaliana	NNNNBDNDNNYHCACGCGCYD	HRGCGCGTGDRNNHNHVNNNN	Dap-seq OMalley et al.(2016) FAR1_colamp_a	0.909	0.909
FHY3 M08114_2.00	Arabidopsis thaliana	NHCACGCGCTNN	NNAGCGCGTGDN	ChIP-seq Mathelier et al.(2014) MA0557.1	0.716	0.716
FHY3 M09540_2.00	Arabidopsis thaliana	NHSACGCGCBNN	NNVGCGCGTSDN	Misc Heinz et al.(2010) Arabidopsis-FHY3_GSE30711	0.716	0.716
For this family, TFs with SR scores > 0.700* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
POPTR_0006s02140.1	FAR1	77	164	SFYQEYAKSMGFTTSIKNSRRSKKSKEFIDAKFACSRYGVTPESDSGNSRRSTVKKTDCKASMHVKRRADGKWIIHEFVKEHNHELLP

Links
Other FAR1 family TFs
Other *Populus trichocarpa* TFs

Invalid Input OrderBy

52 Related TFs

Name	Species	Gene ID	Motif Evidence	SR Score	Action