TF Information

CPAG_03572 *(Candida parapsilosis)* Forkhead
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source
PF00250 (Forkhead)	IPR001766	CPAG_03572	T184352_2.00	Broad (2016-May-1)
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
FKH2 M00045_2.00	Saccharomyces cerevisiae	GTAAACAH	DTGTTTAC	PBM Badis et al.(2008) FKH2_4517	0.773	0.826
FKH2 M01542_2.00	Saccharomyces cerevisiae	NNVWMAAYAN	NTRTTKWBNN	PBM Zhu et al.(2009) Fkh2	0.773	0.826
FKH2 M07474_2.00	Saccharomyces cerevisiae	GTAAACA	TGTTTAC	PBM, CSA and or DIP-chip Mathelier et al.(2014) MA0297.1	0.773	0.826
FKH2 M08556_2.00	Saccharomyces cerevisiae	NNNNDNGTAAACAAANNNDV	BHNNNTTTGTTTACNHNNNN	Misc DeBoer et al.(2011) YNL068C_830	0.773	0.826
FKH1 M01541_2.00	Saccharomyces cerevisiae	NNRTMAAYAN	NTRTTKAYNN	PBM Zhu et al.(2009) Fkh1	0.690	0.674
FKH1 M08555_2.00	Saccharomyces cerevisiae	NNGTAAACADVN	NBHTGTTTACNN	Misc DeBoer et al.(2011) YIL131C_2002	0.690	0.674
Foxj2 M01980_2.00	Mus musculus	RTAAACAN	NTGTTTAY	PBM Weirauch et al.(2014) pTH6638	0.664	0.547
For this family, TFs with SR scores > 0.664* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
CPAG_03572.1	Forkhead	269	358	KPPYSYATMITQAILSDPHGVMSLSDIYNWISDRYAYYRFSKTGWQNSIRHNLSLNKAFEKVPRKPNEPGKGMKWQISESYKQDFLKKLN

Links
Other Forkhead family TFs
Other *Candida parapsilosis* TFs

Invalid Input OrderBy

86 Related TFs

Name	Species	Gene ID	Motif Evidence	SR Score	Action