TF Information

PGUG_02044 *(Candida guilliermondii)* Forkhead
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source
PF00250 (Forkhead)	IPR001766	PGUG_02044	T184379_2.00	Broad (2016-May-1)
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
FKH2 M00045_2.00	Saccharomyces cerevisiae	GTAAACAH	DTGTTTAC	PBM Badis et al.(2008) FKH2_4517	0.790	0.802
FKH2 M01542_2.00	Saccharomyces cerevisiae	NNVWMAAYAN	NTRTTKWBNN	PBM Zhu et al.(2009) Fkh2	0.790	0.802
FKH2 M07474_2.00	Saccharomyces cerevisiae	GTAAACA	TGTTTAC	PBM, CSA and or DIP-chip Mathelier et al.(2014) MA0297.1	0.790	0.802
FKH2 M08556_2.00	Saccharomyces cerevisiae	NNNNDNGTAAACAAANNNDV	BHNNNTTTGTTTACNHNNNN	Misc DeBoer et al.(2011) YNL068C_830	0.790	0.802
FKH1 M01541_2.00	Saccharomyces cerevisiae	NNRTMAAYAN	NTRTTKAYNN	PBM Zhu et al.(2009) Fkh1	0.706	0.616
FKH1 M08555_2.00	Saccharomyces cerevisiae	NNGTAAACADVN	NBHTGTTTACNN	Misc DeBoer et al.(2011) YIL131C_2002	0.706	0.616
Foxj2 M01980_2.00	Mus musculus	RTAAACAN	NTGTTTAY	PBM Weirauch et al.(2014) pTH6638	0.664	0.547
FOXK2 M08118_2.00	Homo sapiens	NNRTAAACANN	NNTGTTTAYNN	ChIP-seq Mathelier et al.(2014) MA1103.1	0.664	0.523
For this family, TFs with SR scores > 0.664* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
PGUT_02044	Forkhead	249	338	KPPYSYATMITQAILSNPDGVMSLAEIYNWIASHYAYYKYSKTGWQNSIRHNLSLNKAFEKVPRRPNEPGKGMKWQISESYKEEFMNKVQ

Links
Other Forkhead family TFs
Other *Candida guilliermondii* TFs

Invalid Input OrderBy

206 Related TFs

Name	Species	Gene ID	Motif Evidence	SR Score	Action