TF Information

KLTH0A06534g *(Lachancea thermotolerans)* Forkhead
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source	Animal TF db
PF00250 (Forkhead)	IPR001766	KLTH0A06534g	T187872_2.00	Ensembl (2018-Dec-8)	Link out
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
HCM1 M00044_2.00	Saccharomyces cerevisiae	NRWHAACAN	NTGTTDWYN	PBM Badis et al.(2008) HCM1_2157	0.696	0.714
HCM1 M07473_2.00	Saccharomyces cerevisiae	VWMAACAH	DTGTTKWB	PBM, CSA and or DIP-chip Mathelier et al.(2014) MA0317.1	0.696	0.714
HCM1 M08554_2.00	Saccharomyces cerevisiae	VWMAACAH	DTGTTKWB	Misc DeBoer et al.(2011) YCR065W_570	0.696	0.714
NCU06173 M01992_2.00	Neurospora crassa	RTAAACAH	DTGTTTAY	PBM Weirauch et al.(2014) pTH8896	0.689	0.595
For this family, TFs with SR scores > 0.664* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
CAR21299	Forkhead	108	195	KPPFSYAMLIGLAILQSTEVRLTLSQIYQWITYHFPYYKLGDYGWQNSIRHNLSLNEAFVKGEKAPDGKGHYWQVKSGCEGKFFKSGQ

Links
Other Forkhead family TFs
Other *Lachancea thermotolerans* TFs

Invalid Input OrderBy

118 Related TFs

Name	Species	Gene ID	Motif Evidence	SR Score	Action