CIS-BP Database: Catalog of Inferred Sequence Binding Preferences

TF Information

MESCA006276 *(Megaselia scalaris)* Forkhead
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source	Animal TF db
PF00250 (Forkhead)	IPR001766	MESCA006276	T188078_2.00	Ensembl (2018-Dec-8)	Link out
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
fd59A M03739_2.00	Drosophila melanogaster	HWAWRTAAACAWW	WWTGTTTAYWTWD	SELEX Nitta et al.(2015) fd59A_1	0.119	1.000
fd59A M03740_2.00	Drosophila melanogaster	WWAVAATAACAHN	NDTGTTATTBTWW	SELEX Nitta et al.(2015) fd59A_2	0.119	1.000
fd59A M03741_2.00	Drosophila melanogaster	YWRWRTAAAYAHH	DDTRTTTAYWYWR	SELEX Nitta et al.(2015) fd59A_3	0.119	1.000
fd59A M03742_2.00	Drosophila melanogaster	MWACAAYAAYAHW	WDTRTTRTTGTWK	SELEX Nitta et al.(2015) fd59A_4	0.119	1.000
For this family, TFs with SR scores > 0.664* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
MESCA006276-PA	Forkhead	1	56	FPYYKDKFPAWQNSIRHNLSLNDCFIKVPREPGNPGKGNFWTLDPLAEDMFDNGSF

Links
Other Forkhead family TFs
Other *Megaselia scalaris* TFs