TF Information

PAS_chr4_0205 *(Komagataella pastoris)* Forkhead
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source	Animal TF db
PF00250 (Forkhead)	IPR001766	PAS_chr4_0205	T188252_2.00	Ensembl (2018-Dec-8)	Link out
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
FKH2 M00045_2.00	Saccharomyces cerevisiae	GTAAACAH	DTGTTTAC	PBM Badis et al.(2008) FKH2_4517	0.751	0.767
FKH2 M01542_2.00	Saccharomyces cerevisiae	NNVWMAAYAN	NTRTTKWBNN	PBM Zhu et al.(2009) Fkh2	0.751	0.767
FKH2 M07474_2.00	Saccharomyces cerevisiae	GTAAACA	TGTTTAC	PBM, CSA and or DIP-chip Mathelier et al.(2014) MA0297.1	0.751	0.767
FKH2 M08556_2.00	Saccharomyces cerevisiae	NNNNDNGTAAACAAANNNDV	BHNNNTTTGTTTACNHNNNN	Misc DeBoer et al.(2011) YNL068C_830	0.751	0.767
FKH1 M01541_2.00	Saccharomyces cerevisiae	NNRTMAAYAN	NTRTTKAYNN	PBM Zhu et al.(2009) Fkh1	0.673	0.616
FKH1 M08555_2.00	Saccharomyces cerevisiae	NNGTAAACADVN	NBHTGTTTACNN	Misc DeBoer et al.(2011) YIL131C_2002	0.673	0.616
For this family, TFs with SR scores > 0.664* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
CAY71431	Forkhead	273	362	KPPYSYATMITQAILTNEQGILSLSEIYDWISSHYSYYRFSKTGWQNSIRHNLSLNKAFEKVPRRPNEPGKGMKWQISEAYKQDFMKKWR

Links
Other Forkhead family TFs
Other *Komagataella pastoris* TFs

Invalid Input OrderBy

126 Related TFs

Name	Species	Gene ID	Motif Evidence	SR Score	Action