TF Information

PTTG_05015 *(Puccinia triticina)* Forkhead
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source	Animal TF db
PF00250 (Forkhead)	IPR001766	PTTG_05015	T188399_2.00	Ensembl (2018-Dec-8)	Link out
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
fd59A M03739_2.00	Drosophila melanogaster	HWAWRTAAACAWW	WWTGTTTAYWTWD	SELEX Nitta et al.(2015) fd59A_1	0.719	0.558
fd59A M03740_2.00	Drosophila melanogaster	WWAVAATAACAHN	NDTGTTATTBTWW	SELEX Nitta et al.(2015) fd59A_2	0.719	0.558
fd59A M03741_2.00	Drosophila melanogaster	YWRWRTAAAYAHH	DDTRTTTAYWYWR	SELEX Nitta et al.(2015) fd59A_3	0.719	0.558
fd59A M03742_2.00	Drosophila melanogaster	MWACAAYAAYAHW	WDTRTTRTTGTWK	SELEX Nitta et al.(2015) fd59A_4	0.719	0.558
FOXD4L4 M10564_2.00	Homo sapiens	Transfac license required	Transfac license required	Transfac Matys et al.(2006) V$FOXD4L4_01	0.698	0.523
For this family, TFs with SR scores > 0.664* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
PTTG_05015P0	Forkhead	782	870	KPGYPYVVLIRYAILGSPHGKLTLQELYETIMDRFPYYRTAGKGWMNSIRHNLSLNRCFVKQPRHILDPGKGSYWTVDLEAELSTSRAR

Links
Other Forkhead family TFs
Other *Puccinia triticina* TFs

Invalid Input OrderBy

76 Related TFs

Name	Species	Gene ID	Motif Evidence	SR Score	Action