TF Information

e_gw1.8.572.1 *(Mucor circinelloides)* Forkhead
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source
PF00250 (Forkhead)	IPR001766	e_gw1.8.572.1	T189257_2.00	JGI (2012-Mar-17)
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
Foxp2 M00792_2.00	Mus musculus	RTAAACAD	HTGTTTAY	PBM Weirauch et al.(2013) pTH1288	0.686	0.429
FOXP2 M05866_2.00	Homo sapiens	RTAAAYAWNN	NNWTRTTTAY	SMiLE-seq Isakova et al.(2017) FOXP2	0.686	0.429
FOXP2 M08116_2.00	Homo sapiens	NDGTAAACAVN	NBTGTTTACHN	ChIP-seq Mathelier et al.(2014) MA0593.1	0.686	0.429
FOXP2 M09089_2.00	Homo sapiens	DGTAAACAV	BTGTTTACH	Misc Kulakovskiy et al.(2013) FOXP2_HUMAN.H11MO.0.C	0.686	0.429
Foxp2 M09101_2.00	Mus musculus	NGTAAACAN	NTGTTTACN	Misc Kulakovskiy et al.(2013) FOXP2_MOUSE.H11MO.0.A	0.686	0.429
SPU_025010 M01988_2.00	Strongylocentrotus purpuratus	NNVNHHAYAN	NTRTDDNBNN	PBM Weirauch et al.(2014) pTH6641	0.667	0.558
HCM1 M00044_2.00	Saccharomyces cerevisiae	NRWHAACAN	NTGTTDWYN	PBM Badis et al.(2008) HCM1_2157	0.666	0.545
HCM1 M07473_2.00	Saccharomyces cerevisiae	VWMAACAH	DTGTTKWB	PBM, CSA and or DIP-chip Mathelier et al.(2014) MA0317.1	0.666	0.545
HCM1 M08554_2.00	Saccharomyces cerevisiae	VWMAACAH	DTGTTKWB	Misc DeBoer et al.(2011) YCR065W_570	0.666	0.545
For this family, TFs with SR scores > 0.664* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
e_gw1.8.572.1	Forkhead	26	105	KPPYSYATLIAHAILASKDGRLTLNDIYTWISKHYPSFSVGNGGWQNSIRHNLSLNKKWFYKIDRRPTQANPGKGCYWTL

Links
Other Forkhead family TFs
Other *Mucor circinelloides* TFs

Invalid Input OrderBy

233 Related TFs

Name	Species	Gene ID	Motif Evidence	SR Score	Action