TF Information

estExt_fgeneshPB_pg.C_280113 *(Phycomyces blakesleeanus)* Forkhead
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source
PF00250 (Forkhead)	IPR001766	estExt_fgeneshPB_pg.C_280113	T189300_2.00	JGI (2012-Mar-17)
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
NCU06173 M01992_2.00	Neurospora crassa	RTAAACAH	DTGTTTAY	PBM Weirauch et al.(2014) pTH8896	0.689	0.558
HCM1 M00044_2.00	Saccharomyces cerevisiae	NRWHAACAN	NTGTTDWYN	PBM Badis et al.(2008) HCM1_2157	0.669	0.570
HCM1 M07473_2.00	Saccharomyces cerevisiae	VWMAACAH	DTGTTKWB	PBM, CSA and or DIP-chip Mathelier et al.(2014) MA0317.1	0.669	0.570
HCM1 M08554_2.00	Saccharomyces cerevisiae	VWMAACAH	DTGTTKWB	Misc DeBoer et al.(2011) YCR065W_570	0.669	0.570
fd64A M06197_2.00	Drosophila melanogaster	KVWAAACA	TGTTTWBM	B1H Zhu et al.(2011) fd64A_SANGER_5_FBgn0004895	0.664	0.535
For this family, TFs with SR scores > 0.664* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
estExt_fgeneshPB_pg.C_280113	Forkhead	145	236	KPPYSYATLIAHAILSSTNRRLTLSEIYSWITTHYPYYSAGEHGWQNSIRHNLSLNKAFVKLDRTSSKTTLCGKGSFWTIQLGSEKPFIENL

Links
Other Forkhead family TFs
Other *Phycomyces blakesleeanus* TFs

Invalid Input OrderBy

199 Related TFs

Name	Species	Gene ID	Motif Evidence	SR Score	Action