TF Information

DILT_0000033401 *(Diphyllobothrium latum)* Forkhead
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source
PF00250 (Forkhead)	IPR001766	DILT_0000033401	T190451_2.00	WormBase:ParaSite (2015-Oct-22)
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
FOXK2 M08118_2.00	Homo sapiens	NNRTAAACANN	NNTGTTTAYNN	ChIP-seq Mathelier et al.(2014) MA1103.1	0.689	0.718
FOXD4L4 M10564_2.00	Homo sapiens	Transfac license required	Transfac license required	Transfac Matys et al.(2006) V$FOXD4L4_01	0.676	0.553
fd59A M03739_2.00	Drosophila melanogaster	HWAWRTAAACAWW	WWTGTTTAYWTWD	SELEX Nitta et al.(2015) fd59A_1	0.673	0.576
fd59A M03740_2.00	Drosophila melanogaster	WWAVAATAACAHN	NDTGTTATTBTWW	SELEX Nitta et al.(2015) fd59A_2	0.673	0.576
fd59A M03741_2.00	Drosophila melanogaster	YWRWRTAAAYAHH	DDTRTTTAYWYWR	SELEX Nitta et al.(2015) fd59A_3	0.673	0.576
fd59A M03742_2.00	Drosophila melanogaster	MWACAAYAAYAHW	WDTRTTRTTGTWK	SELEX Nitta et al.(2015) fd59A_4	0.673	0.576
SPU_025010 M01988_2.00	Strongylocentrotus purpuratus	NNVNHHAYAN	NTRTDDNBNN	PBM Weirauch et al.(2014) pTH6641	0.670	0.753
For this family, TFs with SR scores > 0.664* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
DILT_0000033401-mRNA-1	Forkhead	41	125	KPPYSYAQLIIQAIASAPHRRLALSDIYAYIYCNFPYYKPNQKGWQNSIRHNLSLNRYFIRVPRSQEEPGKGAFWRLDPESEARL

Links
Other Forkhead family TFs
Other *Diphyllobothrium latum* TFs

Invalid Input OrderBy

216 Related TFs

Name	Species	Gene ID	Motif Evidence	SR Score	Action