TF Information

MCOS_0000840801 *(Mesocestoides corti)* Forkhead
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source
PF00250 (Forkhead)	IPR001766	MCOS_0000840801	T190789_2.00	WormBase:ParaSite (2015-Oct-22)
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
fd64A M06197_2.00	Drosophila melanogaster	KVWAAACA	TGTTTWBM	B1H Zhu et al.(2011) fd64A_SANGER_5_FBgn0004895	0.687	0.594
FOXF1 M10529_2.00	Homo sapiens	Transfac license required	Transfac license required	Transfac Matys et al.(2006) V$FKHL5_Q3	0.677	0.828
FOXF1 M10530_2.00	Homo sapiens	YRHATAAACAHNB	VNDTGTTTATDYR	Transfac Matys et al.(2006) V$HFH8_01	0.677	0.828
FOXF2 M02680_2.00	Homo sapiens	BNHNSRTAAACAHN	NDTGTTTAYSNDNV	SELEX Mathelier et al.(2014) MA0030.1	0.676	0.797
FOXF2 M10548_2.00	Homo sapiens	BNHNBRTAAACAHNVN	NBNDTGTTTAYVNDNV	Transfac Matys et al.(2006) V$FREAC2_01	0.676	0.797
For this family, TFs with SR scores > 0.664* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
MCOS_0000840801-mRNA-1	Forkhead	8	71	KPPYSYIALIAMAIRASPNKRCTLSEIYQYLHSKYPFFRGSYTGWKNSVRHNLSLNEVFIKLPK

Links
Other Forkhead family TFs
Other *Mesocestoides corti* TFs

Invalid Input OrderBy

183 Related TFs

Name	Species	Gene ID	Motif Evidence	SR Score	Action