TF Information

LALA0_S04e03466g *(Lachancea lanzarotensis)* GCR1
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source	Animal TF db
PF12550 (GCR1_C)	IPR022210	LALA0_S04e03466g	T198549_2.00	Ensembl (2018-Dec-8)	Link out
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
GCR1 M00914_2.00	Saccharomyces cerevisiae	RGVDDCBWVW	WBWVGHHBCY	PBM Gordan et al.(2011) Gcr1	0.747	0.747
GCR1 M08569_2.00	Saccharomyces cerevisiae	VCTTCCH	DGGAAGB	Misc DeBoer et al.(2011) YPL075W_2071	0.747	0.747
GCR1 M10606_2.00	Saccharomyces cerevisiae	RKCTTCCWS	SWGGAAGYY	Transfac Matys et al.(2006) F$GCR1_01	0.747	0.747
GCR1 M10607_2.00	Saccharomyces cerevisiae	Transfac license required	Transfac license required	Transfac Matys et al.(2006) F$GCR1_B	0.747	0.747
GCR1 M10608_2.00	Saccharomyces cerevisiae	Transfac license required	Transfac license required	Transfac Matys et al.(2006) F$GCR1_Q4	0.747	0.747
GCR1 M08456_2.00	Saccharomyces cerevisiae	RKCTTCCW	WGGAAGMY	COMPILED Mathelier et al.(2014) MA0304.1	0.747	0.747
For this family, TFs with SR scores > 0.700* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
CEP61911	GCR1	541	631	YKLSRENKTVWDLYNEWYVGLNGDPSIKYLIDTYGWRRWKVGEDSHFFPTRRIIIDYIEREVDRGVRAGRFLNTDRESMRKVITDDLEKFR

Links
Other GCR1 family TFs
Other *Lachancea lanzarotensis* TFs

Invalid Input OrderBy

23 Related TFs

Name	Species	Gene ID	Motif Evidence	SR Score	Action