TF Information

22088_YOL116W *(Saccharomyces bayanus)* GCR1
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source
PF12550 (GCR1_C)	IPR022210	22088_YOL116W	T198742_2.00	Superfamily (2010-Oct-26)
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
MSN1 M00913_2.00	Saccharomyces cerevisiae	NWWTGTCCHN	NDGGACAWWN	PBM Gordan et al.(2011) Msn1	0.987	0.987
MSN1 M08567_2.00	Saccharomyces cerevisiae	GTCCNHAT	ATDNGGAC	Misc DeBoer et al.(2011) YOL116W_1376	0.987	0.987
MSN1 M08568_2.00	Saccharomyces cerevisiae	HATGTCCH	DGGACATD	Misc DeBoer et al.(2011) YOL116W_1378	0.987	0.987
For this family, TFs with SR scores > 0.700* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
22088_YOL116W	GCR1	277	355	FEFIKSPHSVMEVWKEYTEGVNGQPSIRKMEALYQTAWRRDPAVNKRYSRRKVLWKAIQTGLNRGYSLNYVIEILENSR

Links
Other GCR1 family TFs
Other *Saccharomyces bayanus* TFs

Invalid Input OrderBy

12 Related TFs

Name	Species	Gene ID	Motif Evidence	SR Score	Action