TF Information

CpipJ_CPIJ003723 *(Culex pipiens)* Homeodomain
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source
PF00046 (Homeobox)	IPR001356	CpipJ_CPIJ003723	T203679_2.00	Broad (2016-May-1)
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
CG15696 M02125_2.00	Drosophila melanogaster	NNYWATHNN	NNDATWRNN	PBM Weirauch et al.(2014) pTH6445	0.692	0.807
CG15696 M06540_2.00	Drosophila melanogaster	TTRATTR	YAATYAA	B1H Mathelier et al.(2014) MA0176.1	0.692	0.807
CG15696 M06356_2.00	Drosophila melanogaster	BTTRATTR	YAATYAAV	B1H Zhu et al.(2011) CG15696_Cell_FBgn0038833	0.692	0.807
CG15696 M06357_2.00	Drosophila melanogaster	NHTWATTR	YAATWADN	B1H Zhu et al.(2011) CG15696_SOLEXA_FBgn0038833	0.692	0.807
For this family, TFs with SR scores > 0.599* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
CpipJ_CPIJ003723-RA	Homeodomain	151	207	RLPRVPFTPSQLSALEDAYKVSTYLSSEEANQLAYSLELTNTRVKIWFQNRRARDRR

Links
Other Homeodomain family TFs
Other *Culex pipiens* TFs

Invalid Input OrderBy

61 Related TFs

Name	Species	Gene ID	Motif Evidence	SR Score	Action