TF Information

AC235534.1_FG007 *(Zea mays)* Homeodomain
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source	Animal TF db
PF00046 (Homeobox)	IPR001356	AC235534.1_FG007	T204018_2.00	Ensembl (2018-Dec-8)	Link out
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
HDG11 M02039_2.00	Arabidopsis thaliana	DCATTWAWKD	HMWTWAATGH	PBM Weirauch et al.(2014) pTH7664	0.619	0.732
HDG11 M06904_2.00	Arabidopsis thaliana	DCATTWAWTRH	DYAWTWAATGH	Dap-seq OMalley et al.(2016) EDT1_col	0.619	0.732
HDG1 M06917_2.00	Arabidopsis thaliana	DCATTAAWTRH	DYAWTTAATGH	Dap-seq OMalley et al.(2016) HDG1_col100_a	0.605	0.732
HDG1 M06918_2.00	Arabidopsis thaliana	DCATTAAWTRH	DYAWTTAATGH	Dap-seq OMalley et al.(2016) HDG1_colamp_a	0.605	0.732
PK24181.1 M01252_2.00	Cannabis sativa	NNNNNNNHDH	DHDNNNNNNN	PBM Lambert et al.(2019) pTH11300	0.603	0.732
For this family, TFs with SR scores > 0.599* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
AC235534.1_FGP007	Homeodomain	137	192	KKPYNRHTPRQIEQLEAMFKEFHHPDEKQRAQLSRQLGLDPRQVKFWFQNRRTHLK

Links
Other Homeodomain family TFs
Other *Zea mays* TFs

Invalid Input OrderBy

99 Related TFs

Name	Species	Gene ID	Motif Evidence	SR Score	Action