TF Information

GSMUA_Achr5G01960_001 *(Musa acuminata)* Homeodomain
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source	Animal TF db
PF00046 (Homeobox)	IPR001356	GSMUA_Achr5G01960_001	T219166_2.00	Ensembl (2018-Dec-8)	Link out
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
KNAT6 M02037_2.00	Arabidopsis thaliana	NNWGACNNNN	NNNNGTCWNN	PBM Weirauch et al.(2014) pTH7296	0.795	0.789
KNOX3_HORVU M10790_2.00	Hordeum vulgare	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$KNOX3_01	0.791	0.877
GRMZM2G135447 M02139_2.00	Zea mays	DTGACRKS	SMYGTCAH	PBM Weirauch et al.(2014) pTH6328	0.748	0.860
GRMZM2G087741 M02138_2.00	Zea mays	NNTGACRKCN	NGMYGTCANN	PBM Weirauch et al.(2014) pTH5816	0.741	0.702
PK25034.1 M01254_2.00	Cannabis sativa	NNTGACRKBN	NVMYGTCANN	PBM Lambert et al.(2019) pTH11259	0.687	0.842
For this family, TFs with SR scores > 0.599* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
GSMUA_Achr5P01960_001	Homeodomain	95	155	KKRKKGKLPKEARQKLLKWWELHYKWPYPSESEKLALAESTGLDQKQINNWFINQRKRHWR

Links
Other Homeodomain family TFs
Other *Musa acuminata* TFs

Invalid Input OrderBy

310 Related TFs

Name	Species	Gene ID	Motif Evidence	SR Score	Action