TF Information

ENSP00000362586 *(Macaca fascicularis)* Homeodomain
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source
PF00046 (Homeobox)	IPR001356	ENSP00000362586	T226090_2.00	GigaDB (2015-Oct-22)
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
PBX3 M08132_2.00	Homo sapiens	NNNTGAGTGACAGSNNN	NNNSCTGTCACTCANNN	ChIP-seq Mathelier et al.(2014) MA1114.1	0.841	0.984
PBX3 M07971_2.00	Homo sapiens	NNBDRCCAATSRVVD	HBBYSATTGGYHVNN	ChIP-seq Gerstein et al.(2012) GM12878_PBX3_HudsonAlpha	0.841	0.984
PBX3 M09155_2.00	Homo sapiens	DGABKGRCRGB	VCYGYCMVTCH	Misc Kulakovskiy et al.(2013) PBX3_HUMAN.H11MO.0.A	0.841	0.984
PBX3 M09560_2.00	Homo sapiens	NTGABTGACAGB	VCTGTCAVTCAN	Misc Heinz et al.(2010) GM12878-PBX3_GSE32465	0.841	0.984
PBX3 M10732_2.00	Homo sapiens	Transfac license required	Transfac license required	Transfac Matys et al.(2006) V$PBX3_02	0.841	0.984
PBX3 M10733_2.00	Homo sapiens	Transfac license required	Transfac license required	Transfac Matys et al.(2006) V$PBX3_03	0.841	0.984
PBX3 M10734_2.00	Homo sapiens	Transfac license required	Transfac license required	Transfac Matys et al.(2006) V$PBX3_04	0.841	0.984
For this family, TFs with SR scores > 0.599* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
ENSP00000362586	Homeodomain	170	216	RRKRRNFSKQATEILNEYFYSHLSNPYPSEEAKEELAKKCSITVSQS
ENSP00000362586	Homeodomain	233	250	QTSVVSNWFGNKRIRYKK

Links
Other Homeodomain family TFs
Other *Macaca fascicularis* TFs

Invalid Input OrderBy

21 Related TFs

Name	Species	Gene ID	Motif Evidence	SR Score	Action