TF Information

Cagra.6160s0026 *(Capsella grandiflora)* Homeodomain
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source
PF00046 (Homeobox)	IPR001356	Cagra.6160s0026	T228257_2.00	JGI:Phytozome (2018-Apr-12)
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
WOX13 M02049_2.00	Arabidopsis thaliana	YTGATTGA	TCAATCAR	PBM Weirauch et al.(2014) pTH6461	0.798	0.667
WOX13 M00866_2.00	Arabidopsis thaliana	NNTGATTGAN	NTCAATCANN	PBM Franco-Zorrilla et al.(2014) WOX13	0.798	0.667
GRMZM2G038252 M02137_2.00	Zea mays	HTRATTGV	BCAATYAD	PBM Weirauch et al.(2014) pTH6141	0.785	0.702
WUS M06905_2.00	Arabidopsis thaliana	TRAWTGAWTGA	TCAWTCAWTYA	Dap-seq OMalley et al.(2016) WUS1_col_a	0.614	0.404
WUS M06906_2.00	Arabidopsis thaliana	TGAWTGAWTGW	WCAWTCAWTCA	Dap-seq OMalley et al.(2016) WUS1_colamp_a	0.614	0.404
For this family, TFs with SR scores > 0.599* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
Cagra.6160s0026.1.p	Homeodomain	76	137	TRHRWTPTSTQLQILESIYEEGSGTPNRRRIREIAIELSEHGQITETNVYNWFQNRRARSKR

Links
Other Homeodomain family TFs
Other *Capsella grandiflora* TFs

Invalid Input OrderBy

336 Related TFs

Name	Species	Gene ID	Motif Evidence	SR Score	Action