TF Information

AMAG_06269 *(Allomyces macrogynus)* HSF
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source
PF00447 (HSF_DNA-bind)	IPR000232	AMAG_06269	T239459_2.00	Broad (2016-May-1)
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
HSFA4A M06947_2.00	Arabidopsis thaliana	NNNRGAABBTTCTAGAANN	NNTTCTAGAAVVTTCYNNN	Dap-seq OMalley et al.(2016) HSF21_col_a	0.341	0.458
HSFB4 M06936_2.00	Arabidopsis thaliana	RGAASNTTCTAGAAN	NTTCTAGAANSTTCY	Dap-seq OMalley et al.(2016) HSFB4_col_a	0.330	0.448
hsf-1 M02249_2.00	Neurospora crassa	NNNTTCBDNN	NNHVGAANNN	PBM Weirauch et al.(2014) pTH8857	0.330	0.406
HSFA6A M06950_2.00	Arabidopsis thaliana	GAASNTTCTAGAANNW	WNNTTCTAGAANSTTC	Dap-seq OMalley et al.(2016) HSFA6A_col_a	0.324	0.469
HSFA6A M06951_2.00	Arabidopsis thaliana	GAASNTTCTAGAA	TTCTAGAANSTTC	Dap-seq OMalley et al.(2016) HSFA6A_colamp_a	0.324	0.469
HSFA6B M06941_2.00	Arabidopsis thaliana	RGAASNTTCTAGA	TCTAGAANSTTCY	Dap-seq OMalley et al.(2016) HSFA6B_colamp_a	0.322	0.448
HSFA6B M06942_2.00	Arabidopsis thaliana	RGAABNTTCTRGAAN	NTTCYAGAANVTTCY	Dap-seq OMalley et al.(2016) HSFA6B_col	0.322	0.448
ANIA_08035 M02247_2.00	Aspergillus nidulans	NNNNTTCYRN	NYRGAANNNN	PBM Weirauch et al.(2014) pTH8231	0.322	0.396
For this family, TFs with SR scores > 0.318* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
AMAG_06269T0	HSF	8	121	FVQKMYSILENGELKDIVSWSASGDSFLVHSPGEFARSVLPRYFKHSNFSSYNRQLNMWGFSKISNLASSPVSTVNSTNSRNGTTEYIEPAWEFRHPFFQRGQVHLLVQIKRKS

Links
Other HSF family TFs
Other *Allomyces macrogynus* TFs

Invalid Input OrderBy

522 Related TFs

Name	Species	Gene ID	Motif Evidence	SR Score	Action