TF Information

AMSG_05141 *(Thecamonas trahens)* HSF
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source
PF00447 (HSF_DNA-bind)	IPR000232	AMSG_05141	T239470_2.00	Broad (2016-May-1)
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
HSFA1B M06948_2.00	Arabidopsis thaliana	GAANNTTCTAGA	TCTAGAANNTTC	Dap-seq OMalley et al.(2016) HSF3_col_a	0.326	0.430
HSFA1B M06949_2.00	Arabidopsis thaliana	TTCYRG	CYRGAA	Dap-seq OMalley et al.(2016) HSF3_colamp_a	0.326	0.430
HSFA1E M06939_2.00	Arabidopsis thaliana	RGAANNTTCTAGA	TCTAGAANNTTCY	Dap-seq OMalley et al.(2016) HSFA1E_col_a	0.322	0.398
HSFA1E M06940_2.00	Arabidopsis thaliana	RGAASNTTCTAGAAN	NTTCTAGAANSTTCY	Dap-seq OMalley et al.(2016) HSFA1E_colamp_a	0.322	0.398
For this family, TFs with SR scores > 0.318* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
AMSG_05141T0	HSF	40	136	FAEAVFDMVSDPATDAWICWSNGGTTFTVFSAYELEKHVFNKYFRHSRFSSFQRQLYTYDFKKVSTVVEDGETQFVFQHPYFQRGRPDLLSHISRRV

Links
Other HSF family TFs
Other *Thecamonas trahens* TFs

Invalid Input OrderBy

88 Related TFs

Name	Species	Gene ID	Motif Evidence	SR Score	Action