TF Information

Bra029226 *(Brassica rapa)* HSF
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source	Animal TF db
PF00447 (HSF_DNA-bind)	IPR000232	Bra029226	T239869_2.00	Ensembl (2018-Dec-8)	Link out
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
HSF4 M03325_2.00	Homo sapiens	GAANNTTCBVGAA	TTCBVGAANNTTC	SELEX Jolma et al.(2013) HSF4_1	0.343	0.386
HSF4 M05509_2.00	Homo sapiens	VGAABVTTCKVGAAN	NTTCBMGAABVTTCB	SELEX Yin et al.(2017) HSF4_eDBD_HT-SELEX	0.343	0.386
HSF4 M10862_2.00	Homo sapiens	Transfac license required	Transfac license required	Transfac Matys et al.(2006) V$HSF4_Q3	0.343	0.386
HSF4 M05510_2.00	Homo sapiens	RGAABVWDCYRGAWN	NWTCYRGHWBVTTCY	SELEX Yin et al.(2017) HSF4_eDBD_Methyl-HT-SELEX	0.343	0.386
HSFA4A M06947_2.00	Arabidopsis thaliana	NNNRGAABBTTCTAGAANN	NNTTCTAGAAVVTTCYNNN	Dap-seq OMalley et al.(2016) HSF21_col_a	0.332	0.489
For this family, TFs with SR scores > 0.318* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
Bra029226.1-P	HSF	37	128	FADVLYEMVDDPSTDSIVSWSQDGKSFIFWDQDKFCSDVLPKFGLSTSPTFFVRLTDIYCFRKVEESEHCEYAHDYFVRGKPELTVEIERQF

Links
Other HSF family TFs
Other *Brassica rapa* TFs

Invalid Input OrderBy

180 Related TFs

Name	Species	Gene ID	Motif Evidence	SR Score	Action