TF Information

GSPATT00030420001 *(Paramecium tetraurelia)* HSF
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source	Animal TF db
PF00447 (HSF_DNA-bind)	IPR000232	GSPATT00030420001	T240865_2.00	Ensembl (2018-Dec-8)	Link out
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
HSFB2A M00869_2.00	Arabidopsis thaliana	NNNNNTTCB	VGAANNNNN	PBM Franco-Zorrilla et al.(2014) HSFB2A	0.356	0.494
HSFB2A M06952_2.00	Arabidopsis thaliana	GAANNTTCYAGA	TCTRGAANNTTC	Dap-seq OMalley et al.(2016) HSF6_col_a	0.356	0.494
HSFB4 M06936_2.00	Arabidopsis thaliana	RGAASNTTCTAGAAN	NTTCTAGAANSTTCY	Dap-seq OMalley et al.(2016) HSFB4_col_a	0.334	0.461
HSFA6B M06941_2.00	Arabidopsis thaliana	RGAASNTTCTAGA	TCTAGAANSTTCY	Dap-seq OMalley et al.(2016) HSFA6B_colamp_a	0.333	0.416
HSFA6B M06942_2.00	Arabidopsis thaliana	RGAABNTTCTRGAAN	NTTCYAGAANVTTCY	Dap-seq OMalley et al.(2016) HSFA6B_col	0.333	0.416
HSFB2B M06945_2.00	Arabidopsis thaliana	RGAANNTTCTAGAA	TTCTAGAANNTTCY	Dap-seq OMalley et al.(2016) HSF7_col_a	0.331	0.483
HSFB2B M06946_2.00	Arabidopsis thaliana	RGAANNTTCTAGAA	TTCTAGAANNTTCY	Dap-seq OMalley et al.(2016) HSF7_colamp_a	0.331	0.483
For this family, TFs with SR scores > 0.318* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
CAK59784	HSF	19	119	FLTKTYDILEVQCCSNIQNSNYSDIIQWNEEGQAFIIKKPYEFAKKILPKYFKHNNYTSFIRQLNIYDFHKIKNELGKHVFRHNFFQKEKKHLLCEIKRKS

Links
Other HSF family TFs
Other *Paramecium tetraurelia* TFs

Invalid Input OrderBy

688 Related TFs

Name	Species	Gene ID	Motif Evidence	SR Score	Action