TF Information

MANI_026021 *(Metarhizium anisopliae)* HSF
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source	Animal TF db
PF00447 (HSF_DNA-bind)	IPR000232	MANI_026021	T241205_2.00	Ensembl (2018-Dec-8)	Link out
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
hsf-1 M02249_2.00	Neurospora crassa	NNNTTCBDNN	NNHVGAANNN	PBM Weirauch et al.(2014) pTH8857	0.467	0.635
ANIA_08035 M02247_2.00	Aspergillus nidulans	NNNNTTCYRN	NYRGAANNNN	PBM Weirauch et al.(2014) pTH8231	0.459	0.615
HSF4 M03325_2.00	Homo sapiens	GAANNTTCBVGAA	TTCBVGAANNTTC	SELEX Jolma et al.(2013) HSF4_1	0.321	0.385
HSF4 M05509_2.00	Homo sapiens	VGAABVTTCKVGAAN	NTTCBMGAABVTTCB	SELEX Yin et al.(2017) HSF4_eDBD_HT-SELEX	0.321	0.385
HSF4 M10862_2.00	Homo sapiens	Transfac license required	Transfac license required	Transfac Matys et al.(2006) V$HSF4_Q3	0.321	0.385
HSF4 M05510_2.00	Homo sapiens	RGAABVWDCYRGAWN	NWTCYRGHWBVTTCY	SELEX Yin et al.(2017) HSF4_eDBD_Methyl-HT-SELEX	0.321	0.385
Hsf2 M09231_2.00	Mus musculus	VGAABVTTCKVGAN	NTCBMGAABVTTCB	Misc Kulakovskiy et al.(2013) HSF2_MOUSE.H11MO.0.A	0.320	0.406
For this family, TFs with SR scores > 0.318* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
KFG77526	HSF	301	405	FIQKLCRFLESKKNEHIIRWSDNGDSILILDENALAKTLIPEAFKHNSYASFVRMLNLYGFQKRVGLSDCSMRAIERKDKRQGEYYSRFFCRRHPNLLWLIHRSP

Links
Other HSF family TFs
Other *Metarhizium anisopliae* TFs

Invalid Input OrderBy

256 Related TFs

Name	Species	Gene ID	Motif Evidence	SR Score	Action