TF Information

PGSC0003DMG400028416 *(Solanum tuberosum)* HSF
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source	Animal TF db
PF00447 (HSF_DNA-bind)	IPR000232	PGSC0003DMG400028416	T241648_2.00	Ensembl (2018-Dec-8)	Link out
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
HSFA4A M06947_2.00	Arabidopsis thaliana	NNNRGAABBTTCTAGAANN	NNTTCTAGAAVVTTCYNNN	Dap-seq OMalley et al.(2016) HSF21_col_a	0.336	0.494
HSFB4 M06936_2.00	Arabidopsis thaliana	RGAASNTTCTAGAAN	NTTCTAGAANSTTCY	Dap-seq OMalley et al.(2016) HSFB4_col_a	0.332	0.483
HSFA6B M06941_2.00	Arabidopsis thaliana	RGAASNTTCTAGA	TCTAGAANSTTCY	Dap-seq OMalley et al.(2016) HSFA6B_colamp_a	0.325	0.494
HSFA6B M06942_2.00	Arabidopsis thaliana	RGAABNTTCTRGAAN	NTTCYAGAANVTTCY	Dap-seq OMalley et al.(2016) HSFA6B_col	0.325	0.494
For this family, TFs with SR scores > 0.318* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
PGSC0003DMT400073065	HSF	41	131	FLVKTYEMVDDPETDPLVHWTSSKTTFLITDPNKFCVEVLPKYFKHSNLSSFIYQLNNYRFRKVCSYKCEYGNPWFRAGKKHWLKNIKSRI

Links
Other HSF family TFs
Other *Solanum tuberosum* TFs

Invalid Input OrderBy

616 Related TFs

Name	Species	Gene ID	Motif Evidence	SR Score	Action