TF Information

PGSC0003DMG400043234 *(Solanum tuberosum)* HSF
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source	Animal TF db
PF00447 (HSF_DNA-bind)	IPR000232	PGSC0003DMG400043234	T241653_2.00	Ensembl (2018-Dec-8)	Link out
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
HSFA6B M06941_2.00	Arabidopsis thaliana	RGAASNTTCTAGA	TCTAGAANSTTCY	Dap-seq OMalley et al.(2016) HSFA6B_colamp_a	0.380	0.552
HSFA6B M06942_2.00	Arabidopsis thaliana	RGAABNTTCTRGAAN	NTTCYAGAANVTTCY	Dap-seq OMalley et al.(2016) HSFA6B_col	0.380	0.552
HSFA1B M06948_2.00	Arabidopsis thaliana	GAANNTTCTAGA	TCTAGAANNTTC	Dap-seq OMalley et al.(2016) HSF3_col_a	0.357	0.540
HSFA1B M06949_2.00	Arabidopsis thaliana	TTCYRG	CYRGAA	Dap-seq OMalley et al.(2016) HSF3_colamp_a	0.357	0.540
HSFA6A M06950_2.00	Arabidopsis thaliana	GAASNTTCTAGAANNW	WNNTTCTAGAANSTTC	Dap-seq OMalley et al.(2016) HSFA6A_col_a	0.350	0.540
HSFA6A M06951_2.00	Arabidopsis thaliana	GAASNTTCTAGAA	TTCTAGAANSTTC	Dap-seq OMalley et al.(2016) HSFA6A_colamp_a	0.350	0.540
HSFA1E M06939_2.00	Arabidopsis thaliana	RGAANNTTCTAGA	TCTAGAANNTTCY	Dap-seq OMalley et al.(2016) HSFA1E_col_a	0.325	0.506
HSFA1E M06940_2.00	Arabidopsis thaliana	RGAASNTTCTAGAAN	NTTCTAGAANSTTCY	Dap-seq OMalley et al.(2016) HSFA1E_colamp_a	0.325	0.506
HSFB2A M00869_2.00	Arabidopsis thaliana	NNNNNTTCB	VGAANNNNN	PBM Franco-Zorrilla et al.(2014) HSFB2A	0.322	0.494
HSFB2A M06952_2.00	Arabidopsis thaliana	GAANNTTCYAGA	TCTRGAANNTTC	Dap-seq OMalley et al.(2016) HSF6_col_a	0.322	0.494
HSFA4A M06947_2.00	Arabidopsis thaliana	NNNRGAABBTTCTAGAANN	NNTTCTAGAAVVTTCYNNN	Dap-seq OMalley et al.(2016) HSF21_col_a	0.320	0.506
For this family, TFs with SR scores > 0.318* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
PGSC0003DMT400093663	HSF	31	121	FVTKTYDMVEDPNSNSIICWSSSGTSFVIWDHNRFSFEVLPKYFKHTNMSSFVYQLNNYGFKKIGLQKWEYGHYWFQAGKKHLLCNIKRRM

Links
Other HSF family TFs
Other *Solanum tuberosum* TFs

Invalid Input OrderBy

785 Related TFs

Name	Species	Gene ID	Motif Evidence	SR Score	Action

PGSC0003DMG400043234 (Solanum tuberosum) HSF

TF Information

Directly determined binding motifs

Motifs from related TFs

DNA Binding Domains

Links

785 Related TFs

Invalid Input OrderBy

PGSC0003DMG400043234 **(Solanum tuberosum)
HSF**