TF Information

scaffold_702873.1 *(Arabidopsis lyrata)* HSF
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source	Animal TF db
PF00447 (HSF_DNA-bind)	IPR000232	scaffold_702873.1	T242024_2.00	Ensembl (2018-Dec-8)	Link out
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
HSFA4A M06947_2.00	Arabidopsis thaliana	NNNRGAABBTTCTAGAANN	NNTTCTAGAAVVTTCYNNN	Dap-seq OMalley et al.(2016) HSF21_col_a	0.336	0.466
HSFA1B M06948_2.00	Arabidopsis thaliana	GAANNTTCTAGA	TCTAGAANNTTC	Dap-seq OMalley et al.(2016) HSF3_col_a	0.326	0.409
HSFA1B M06949_2.00	Arabidopsis thaliana	TTCYRG	CYRGAA	Dap-seq OMalley et al.(2016) HSF3_colamp_a	0.326	0.409
HSFA6B M06941_2.00	Arabidopsis thaliana	RGAASNTTCTAGA	TCTAGAANSTTCY	Dap-seq OMalley et al.(2016) HSFA6B_colamp_a	0.321	0.409
HSFA6B M06942_2.00	Arabidopsis thaliana	RGAABNTTCTRGAAN	NTTCYAGAANVTTCY	Dap-seq OMalley et al.(2016) HSFA6B_col	0.321	0.409
For this family, TFs with SR scores > 0.318* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
scaffold_702873.1	HSF	14	105	LLKKTYEVVDHPSTNSIISWGHDNKSFIIWDLEGFEKFLLPNILSPGNLGVYASYLKLYGFLKVESEQKWEFADDDFVRGHPELLEKITDRY

Links
Other HSF family TFs
Other *Arabidopsis lyrata* TFs

Invalid Input OrderBy

295 Related TFs

Name	Species	Gene ID	Motif Evidence	SR Score	Action