TF Information

SNOG_08309 *(Phaeosphaeria nodorum)* HSF
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source	Animal TF db
PF00447 (HSF_DNA-bind)	IPR000232	SNOG_08309	T242103_2.00	Ensembl (2018-Dec-8)	Link out
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
SFL1 M01556_2.00	Saccharomyces cerevisiae	NNTYCTTCTWNN	NNWAGAAGRANN	PBM Zhu et al.(2009) Sfl1	0.321	0.647
SFL1 M08585_2.00	Saccharomyces cerevisiae	GAAGCTTC	GAAGCTTC	Misc DeBoer et al.(2011) YOR140W_605	0.321	0.647
SFL1 M08586_2.00	Saccharomyces cerevisiae	WHWHNDWYCTTCBRTNHDNDN	NHNHDNAYVGAAGRWHNDWDW	Misc DeBoer et al.(2011) YOR140W_839	0.321	0.647
For this family, TFs with SR scores > 0.318* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
SNOT_08309	HSF	105	195	FIHKLYNMLEDQSIQHLISWSNTNESFVMSPSSEFSKVLSSYFKHTNISSFVRQLNMYGFHKDSPLWEFKHGNGNFKRGDLVGLREIKRRA

Links
Other HSF family TFs
Other *Phaeosphaeria nodorum* TFs

Invalid Input OrderBy

202 Related TFs

Name	Species	Gene ID	Motif Evidence	SR Score	Action