TF Information

Traes_5AL_D369204D3 *(Triticum aestivum)* HSF
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source	Animal TF db
PF00447 (HSF_DNA-bind)	IPR000232	Traes_5AL_D369204D3	T242341_2.00	Ensembl (2018-Dec-8)	Link out
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
HSFB4 M06936_2.00	Arabidopsis thaliana	RGAASNTTCTAGAAN	NTTCTAGAANSTTCY	Dap-seq OMalley et al.(2016) HSFB4_col_a	0.339	0.732
HSFB3 M06937_2.00	Arabidopsis thaliana	RRAANMWTCTAGAAV	BTTCTAGAWKNTTYY	Dap-seq OMalley et al.(2016) HSFB3_col_a	0.332	0.718
HSFB3 M06938_2.00	Arabidopsis thaliana	AABSTTCTAGAAN	NTTCTAGAASVTT	Dap-seq OMalley et al.(2016) HSFB3_colamp_a	0.332	0.718
HSFB2B M06945_2.00	Arabidopsis thaliana	RGAANNTTCTAGAA	TTCTAGAANNTTCY	Dap-seq OMalley et al.(2016) HSF7_col_a	0.327	0.718
HSFB2B M06946_2.00	Arabidopsis thaliana	RGAANNTTCTAGAA	TTCTAGAANNTTCY	Dap-seq OMalley et al.(2016) HSF7_colamp_a	0.327	0.718
HSFB2A M00869_2.00	Arabidopsis thaliana	NNNNNTTCB	VGAANNNNN	PBM Franco-Zorrilla et al.(2014) HSFB2A	0.320	0.704
HSFB2A M06952_2.00	Arabidopsis thaliana	GAANNTTCYAGA	TCTRGAANNTTC	Dap-seq OMalley et al.(2016) HSF6_col_a	0.320	0.704
For this family, TFs with SR scores > 0.318* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
Traes_5AL_D369204D3.1	HSF	1	72	WGEQGRSFVVWKPVELARDLLPLHFKHCNFSSFVRQLNTYGFRKVVPDRWEFANENFRRGEQGLLSGIRRRK

Links
Other HSF family TFs
Other *Triticum aestivum* TFs

Invalid Input OrderBy

349 Related TFs

Name	Species	Gene ID	Motif Evidence	SR Score	Action