TF Information

Traes_5BL_F80E01D65 *(Triticum aestivum)* HSF
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source	Animal TF db
PF00447 (HSF_DNA-bind)	IPR000232	Traes_5BL_F80E01D65	T242346_2.00	Ensembl (2018-Dec-8)	Link out
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
HSFB2B M06945_2.00	Arabidopsis thaliana	RGAANNTTCTAGAA	TTCTAGAANNTTCY	Dap-seq OMalley et al.(2016) HSF7_col_a	0.392	0.677
HSFB2B M06946_2.00	Arabidopsis thaliana	RGAANNTTCTAGAA	TTCTAGAANNTTCY	Dap-seq OMalley et al.(2016) HSF7_colamp_a	0.392	0.677
HSFB3 M06937_2.00	Arabidopsis thaliana	RRAANMWTCTAGAAV	BTTCTAGAWKNTTYY	Dap-seq OMalley et al.(2016) HSFB3_col_a	0.390	0.677
HSFB3 M06938_2.00	Arabidopsis thaliana	AABSTTCTAGAAN	NTTCTAGAASVTT	Dap-seq OMalley et al.(2016) HSFB3_colamp_a	0.390	0.677
HSFB4 M06936_2.00	Arabidopsis thaliana	RGAASNTTCTAGAAN	NTTCTAGAANSTTCY	Dap-seq OMalley et al.(2016) HSFB4_col_a	0.370	0.615
HSFB2A M00869_2.00	Arabidopsis thaliana	NNNNNTTCB	VGAANNNNN	PBM Franco-Zorrilla et al.(2014) HSFB2A	0.362	0.662
HSFB2A M06952_2.00	Arabidopsis thaliana	GAANNTTCYAGA	TCTRGAANNTTC	Dap-seq OMalley et al.(2016) HSF6_col_a	0.362	0.662
HSFA4A M06947_2.00	Arabidopsis thaliana	NNNRGAABBTTCTAGAANN	NNTTCTAGAAVVTTCYNNN	Dap-seq OMalley et al.(2016) HSF21_col_a	0.361	0.585
HSFC1 M00868_2.00	Arabidopsis thaliana	NDTCBNNN	NNNVGAHN	PBM Franco-Zorrilla et al.(2014) HSFC1	0.335	0.508
HSFC1 M06943_2.00	Arabidopsis thaliana	GAASNTTCTAG	CTAGAANSTTC	Dap-seq OMalley et al.(2016) HSFC1_col_a	0.335	0.508
HSFC1 M06944_2.00	Arabidopsis thaliana	RGAASNTTCTAGAANVW	WBNTTCTAGAANSTTCY	Dap-seq OMalley et al.(2016) HSFC1_colamp_a	0.335	0.508
HSFA1E M06939_2.00	Arabidopsis thaliana	RGAANNTTCTAGA	TCTAGAANNTTCY	Dap-seq OMalley et al.(2016) HSFA1E_col_a	0.324	0.585
HSFA1E M06940_2.00	Arabidopsis thaliana	RGAASNTTCTAGAAN	NTTCTAGAANSTTCY	Dap-seq OMalley et al.(2016) HSFA1E_colamp_a	0.324	0.585
For this family, TFs with SR scores > 0.318* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
Traes_5BL_F80E01D65.1	HSF	30	119	FLTKTHQMVEERGTDEVISWSEHGRSFVVWKPVELARDLLPLHFKHCNFSSFVRQLNTYVRIPPSSKHTLSLQYSTSAFAKLITPVCTTD

Links
Other HSF family TFs
Other *Triticum aestivum* TFs

Invalid Input OrderBy

1011 Related TFs

Name	Species	Gene ID	Motif Evidence	SR Score	Action

Traes_5BL_F80E01D65 (Triticum aestivum) HSF

TF Information

Directly determined binding motifs

Motifs from related TFs

DNA Binding Domains

Links

1011 Related TFs

Invalid Input OrderBy

Traes_5BL_F80E01D65 **(Triticum aestivum)
HSF**