TF Information

estExt_fgenesh1_pg.C_chr_60498 *(Mycosphaerella graminicola)* HSF
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source
PF00447 (HSF_DNA-bind)	IPR000232	estExt_fgenesh1_pg.C_chr_60498	T242812_2.00	JGI (2012-Mar-17)
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
SKN7 M00061_2.00	Saccharomyces cerevisiae	AYGGCCRG	CYGGCCRT	PBM Badis et al.(2008) SKN7_2117	0.393	0.635
SKN7 M01555_2.00	Saccharomyces cerevisiae	NBGGCBDNNN	NNNHVGCCVN	PBM Zhu et al.(2009) Skn7	0.393	0.635
SKN7 M07490_2.00	Saccharomyces cerevisiae	GGCCRN	NYGGCC	PBM, CSA and or DIP-chip Mathelier et al.(2014) MA0381.1	0.393	0.635
SKN7 M08582_2.00	Saccharomyces cerevisiae	GBCBVGSCS	SGSCBVGVC	Misc DeBoer et al.(2011) YHR206W_380	0.393	0.635
SKN7 M08583_2.00	Saccharomyces cerevisiae	GGCCRN	NYGGCC	Misc DeBoer et al.(2011) YHR206W_583	0.393	0.635
For this family, TFs with SR scores > 0.318* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
estExt_fgenesh1_pg.C_chr_60498	HSF	15	117	FVRKLYKMLENPQDESIVRWGNEGDSFVVLENEKFTKHILPKHFKHSNFASFVRQLNKYDFHKVRHNNEEGGSSPYGAGAWEFKHPDFKMNNKDALDNIRRKA

Links
Other HSF family TFs
Other *Mycosphaerella graminicola* TFs

Invalid Input OrderBy

260 Related TFs

Name	Species	Gene ID	Motif Evidence	SR Score	Action