TF Information

mgf023919m *(Mimulus guttatus)* HSF
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source
PF00447 (HSF_DNA-bind)	IPR000232	mgf023919m	T242957_2.00	JGI (2012-Mar-17)
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
HSFA4A M06947_2.00	Arabidopsis thaliana	NNNRGAABBTTCTAGAANN	NNTTCTAGAAVVTTCYNNN	Dap-seq OMalley et al.(2016) HSF21_col_a	0.344	0.534
HSFB2A M00869_2.00	Arabidopsis thaliana	NNNNNTTCB	VGAANNNNN	PBM Franco-Zorrilla et al.(2014) HSFB2A	0.338	0.534
HSFB2A M06952_2.00	Arabidopsis thaliana	GAANNTTCYAGA	TCTRGAANNTTC	Dap-seq OMalley et al.(2016) HSF6_col_a	0.338	0.534
HSFA6A M06950_2.00	Arabidopsis thaliana	GAASNTTCTAGAANNW	WNNTTCTAGAANSTTC	Dap-seq OMalley et al.(2016) HSFA6A_col_a	0.327	0.511
HSFA6A M06951_2.00	Arabidopsis thaliana	GAASNTTCTAGAA	TTCTAGAANSTTC	Dap-seq OMalley et al.(2016) HSFA6A_colamp_a	0.327	0.511
For this family, TFs with SR scores > 0.318* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
mgf023919m	HSF	32	123	FLTKTFNIVNDPNTDSVISWSLSGDSFIIWNHHKFSAEILPVYFKHSNLASFVYQLNSYGFRKIGVIHQWEYENPNFQAGKGNLLSNIRRRK

Links
Other HSF family TFs
Other *Mimulus guttatus* TFs

Invalid Input OrderBy

577 Related TFs

Name	Species	Gene ID	Motif Evidence	SR Score	Action