TF Information

Bostr.3359s0057 *(Boechera stricta)* HSF
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source
PF00447 (HSF_DNA-bind)	IPR000232	Bostr.3359s0057	T243004_2.00	JGI:Phytozome (2018-Apr-12)
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
HSFA4A M06947_2.00	Arabidopsis thaliana	NNNRGAABBTTCTAGAANN	NNTTCTAGAAVVTTCYNNN	Dap-seq OMalley et al.(2016) HSF21_col_a	0.371	0.535
HSF4 M03325_2.00	Homo sapiens	GAANNTTCBVGAA	TTCBVGAANNTTC	SELEX Jolma et al.(2013) HSF4_1	0.330	0.349
HSF4 M05509_2.00	Homo sapiens	VGAABVTTCKVGAAN	NTTCBMGAABVTTCB	SELEX Yin et al.(2017) HSF4_eDBD_HT-SELEX	0.330	0.349
HSF4 M10862_2.00	Homo sapiens	Transfac license required	Transfac license required	Transfac Matys et al.(2006) V$HSF4_Q3	0.330	0.349
HSF4 M05510_2.00	Homo sapiens	RGAABVWDCYRGAWN	NWTCYRGHWBVTTCY	SELEX Yin et al.(2017) HSF4_eDBD_Methyl-HT-SELEX	0.330	0.349
HSFA1E M06939_2.00	Arabidopsis thaliana	RGAANNTTCTAGA	TCTAGAANNTTCY	Dap-seq OMalley et al.(2016) HSFA1E_col_a	0.325	0.384
HSFA1E M06940_2.00	Arabidopsis thaliana	RGAASNTTCTAGAAN	NTTCTAGAANSTTCY	Dap-seq OMalley et al.(2016) HSFA1E_colamp_a	0.325	0.384
HSFB3 M06937_2.00	Arabidopsis thaliana	RRAANMWTCTAGAAV	BTTCTAGAWKNTTYY	Dap-seq OMalley et al.(2016) HSFB3_col_a	0.318	0.360
HSFB3 M06938_2.00	Arabidopsis thaliana	AABSTTCTAGAAN	NTTCTAGAASVTT	Dap-seq OMalley et al.(2016) HSFB3_colamp_a	0.318	0.360
For this family, TFs with SR scores > 0.318* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
Bostr.3359s0057.1.p	HSF	15	103	FRKKLYKMVDDPSTDSVVSWSDSGKSFIVWNETEFCRDVLPRFSQYKEMAPFISRLTRMGFKKIESEHWEYGNDDFVRGHPEPEVDLTP

Links
Other HSF family TFs
Other *Boechera stricta* TFs

Invalid Input OrderBy

346 Related TFs

Name	Species	Gene ID	Motif Evidence	SR Score	Action