TF Information

Carubv10006025m.g *(Capsella rubella)* HSF
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source
PF00447 (HSF_DNA-bind)	IPR000232	Carubv10006025m.g	T243050_2.00	JGI:Phytozome (2018-Apr-12)
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
HSFA4A M06947_2.00	Arabidopsis thaliana	NNNRGAABBTTCTAGAANN	NNTTCTAGAAVVTTCYNNN	Dap-seq OMalley et al.(2016) HSF21_col_a	0.335	0.382
HSFB3 M06937_2.00	Arabidopsis thaliana	RRAANMWTCTAGAAV	BTTCTAGAWKNTTYY	Dap-seq OMalley et al.(2016) HSFB3_col_a	0.322	0.371
HSFB3 M06938_2.00	Arabidopsis thaliana	AABSTTCTAGAAN	NTTCTAGAASVTT	Dap-seq OMalley et al.(2016) HSFB3_colamp_a	0.322	0.371
For this family, TFs with SR scores > 0.318* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
Carubv10006025m	HSF	12	104	FHMRIYKVVEDPSSDSVISWGKDNNSFVIWNLEEFTRRDIVGDFDCSRFSEFRSELRYYGFKRIKKGSGELEYGNEDFVRGQPERLKTMMIKA

Links
Other HSF family TFs
Other *Capsella rubella* TFs

Invalid Input OrderBy

152 Related TFs

Name	Species	Gene ID	Motif Evidence	SR Score	Action