TF Information

Carubv10007333m.g *(Capsella rubella)* HSF
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source
PF00447 (HSF_DNA-bind)	IPR000232	Carubv10007333m.g	T243053_2.00	JGI:Phytozome (2018-Apr-12)
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
HSFA4A M06947_2.00	Arabidopsis thaliana	NNNRGAABBTTCTAGAANN	NNTTCTAGAAVVTTCYNNN	Dap-seq OMalley et al.(2016) HSF21_col_a	0.377	0.440
HSFC1 M00868_2.00	Arabidopsis thaliana	NDTCBNNN	NNNVGAHN	PBM Franco-Zorrilla et al.(2014) HSFC1	0.349	0.393
HSFC1 M06943_2.00	Arabidopsis thaliana	GAASNTTCTAG	CTAGAANSTTC	Dap-seq OMalley et al.(2016) HSFC1_col_a	0.349	0.393
HSFC1 M06944_2.00	Arabidopsis thaliana	RGAASNTTCTAGAANVW	WBNTTCTAGAANSTTCY	Dap-seq OMalley et al.(2016) HSFC1_colamp_a	0.349	0.393
HSFB3 M06937_2.00	Arabidopsis thaliana	RRAANMWTCTAGAAV	BTTCTAGAWKNTTYY	Dap-seq OMalley et al.(2016) HSFB3_col_a	0.326	0.357
HSFB3 M06938_2.00	Arabidopsis thaliana	AABSTTCTAGAAN	NTTCTAGAASVTT	Dap-seq OMalley et al.(2016) HSFB3_colamp_a	0.326	0.357
HSFB2B M06945_2.00	Arabidopsis thaliana	RGAANNTTCTAGAA	TTCTAGAANNTTCY	Dap-seq OMalley et al.(2016) HSF7_col_a	0.322	0.417
HSFB2B M06946_2.00	Arabidopsis thaliana	RGAANNTTCTAGAA	TTCTAGAANNTTCY	Dap-seq OMalley et al.(2016) HSF7_colamp_a	0.322	0.417
HSF4 M03325_2.00	Homo sapiens	GAANNTTCBVGAA	TTCBVGAANNTTC	SELEX Jolma et al.(2013) HSF4_1	0.320	0.345
HSF4 M05509_2.00	Homo sapiens	VGAABVTTCKVGAAN	NTTCBMGAABVTTCB	SELEX Yin et al.(2017) HSF4_eDBD_HT-SELEX	0.320	0.345
HSF4 M10862_2.00	Homo sapiens	Transfac license required	Transfac license required	Transfac Matys et al.(2006) V$HSF4_Q3	0.320	0.345
HSF4 M05510_2.00	Homo sapiens	RGAABVWDCYRGAWN	NWTCYRGHWBVTTCY	SELEX Yin et al.(2017) HSF4_eDBD_Methyl-HT-SELEX	0.320	0.345
For this family, TFs with SR scores > 0.318* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
Carubv10007333m	HSF	18	105	FVTKLYELVDDPSTDSLISWGPNGDTIIISNPLKCCRDIFPQYLGVRNFMRFLQYGFEMVEESRQLEYACDDFVKGQPELLDKIGQRY

Links
Other HSF family TFs
Other *Capsella rubella* TFs

Invalid Input OrderBy

698 Related TFs

Name	Species	Gene ID	Motif Evidence	SR Score	Action

Carubv10007333m.g (Capsella rubella) HSF

TF Information

Directly determined binding motifs

Motifs from related TFs

DNA Binding Domains

Links

698 Related TFs

Invalid Input OrderBy

Carubv10007333m.g **(Capsella rubella)
HSF**