TF Information

Thhalv10003411m.g *(Eutrema salsugineum)* HSF
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source
PF00447 (HSF_DNA-bind)	IPR000232	Thhalv10003411m.g	T243409_2.00	JGI:Phytozome (2018-Apr-12)
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
HSFB3 M06937_2.00	Arabidopsis thaliana	RRAANMWTCTAGAAV	BTTCTAGAWKNTTYY	Dap-seq OMalley et al.(2016) HSFB3_col_a	0.343	0.345
HSFB3 M06938_2.00	Arabidopsis thaliana	AABSTTCTAGAAN	NTTCTAGAASVTT	Dap-seq OMalley et al.(2016) HSFB3_colamp_a	0.343	0.345
HSFA4A M06947_2.00	Arabidopsis thaliana	NNNRGAABBTTCTAGAANN	NNTTCTAGAAVVTTCYNNN	Dap-seq OMalley et al.(2016) HSF21_col_a	0.340	0.425
HSFB2A M00869_2.00	Arabidopsis thaliana	NNNNNTTCB	VGAANNNNN	PBM Franco-Zorrilla et al.(2014) HSFB2A	0.332	0.345
HSFB2A M06952_2.00	Arabidopsis thaliana	GAANNTTCYAGA	TCTRGAANNTTC	Dap-seq OMalley et al.(2016) HSF6_col_a	0.332	0.345
HSFA6B M06941_2.00	Arabidopsis thaliana	RGAASNTTCTAGA	TCTAGAANSTTCY	Dap-seq OMalley et al.(2016) HSFA6B_colamp_a	0.325	0.356
HSFA6B M06942_2.00	Arabidopsis thaliana	RGAABNTTCTRGAAN	NTTCYAGAANVTTCY	Dap-seq OMalley et al.(2016) HSFA6B_col	0.325	0.356
HSFA6A M06950_2.00	Arabidopsis thaliana	GAASNTTCTAGAANNW	WNNTTCTAGAANSTTC	Dap-seq OMalley et al.(2016) HSFA6A_col_a	0.324	0.333
HSFA6A M06951_2.00	Arabidopsis thaliana	GAASNTTCTAGAA	TTCTAGAANSTTC	Dap-seq OMalley et al.(2016) HSFA6A_colamp_a	0.324	0.333
For this family, TFs with SR scores > 0.318* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
Thhalv10003411m	HSF	14	105	FKLLYTVVDDPSLDSIISWSNSNKSFVIWNPEELHQRKIFESHYYGCEFPEFLAVLKTYGFERVKGAGRLEFANANFVRGQPKLLGKLQSKA

Links
Other HSF family TFs
Other *Eutrema salsugineum* TFs

Invalid Input OrderBy

545 Related TFs

Name	Species	Gene ID	Motif Evidence	SR Score	Action