TF Information

Thhalv10028026m.g *(Eutrema salsugineum)* HSF
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source
PF00447 (HSF_DNA-bind)	IPR000232	Thhalv10028026m.g	T243431_2.00	JGI:Phytozome (2018-Apr-12)
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
HSFA4A M06947_2.00	Arabidopsis thaliana	NNNRGAABBTTCTAGAANN	NNTTCTAGAAVVTTCYNNN	Dap-seq OMalley et al.(2016) HSF21_col_a	0.340	0.471
HSFA6B M06941_2.00	Arabidopsis thaliana	RGAASNTTCTAGA	TCTAGAANSTTCY	Dap-seq OMalley et al.(2016) HSFA6B_colamp_a	0.321	0.435
HSFA6B M06942_2.00	Arabidopsis thaliana	RGAABNTTCTRGAAN	NTTCYAGAANVTTCY	Dap-seq OMalley et al.(2016) HSFA6B_col	0.321	0.435
For this family, TFs with SR scores > 0.318* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
Thhalv10028026m	HSF	12	102	FYTKLYQIVDDPSFNRIISWGKNNNSFIVWDVEGFRRRILPMFAEFGRDFSKFESELFIHGFRRIGQYEFGHEDFVRGVPELLMKKMSVKS

Links
Other HSF family TFs
Other *Eutrema salsugineum* TFs

Invalid Input OrderBy

245 Related TFs

Name	Species	Gene ID	Motif Evidence	SR Score	Action