TF Information

ENSBTAP00000044267-D1 *(Bos grunniens)* IRF
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source
PF00605 (IRF)	IPR001346	ENSBTAP00000044267-D1	T244532_2.00	GigaDB (2015-Oct-22)
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
IRF9 M02258_2.00	Sus scrofa	WNYGAAASY	RSTTTCRNW	PBM Weirauch et al.(2014) pTH9287	0.913	0.913
IRF9 M02257_2.00	Ochotona princeps	DNYRAAAVND	HNBTTTYRNH	PBM Weirauch et al.(2014) pTH9337	0.875	0.875
Irf9 M00173_2.00	Mus musculus	NNNRAAANN	NNTTTYNNN	PBM Badis et al.(2009) Isgf3g_2853	0.788	0.788
Irf9 M09240_2.00	Mus musculus	GAAABHGAAAYT	ARTTTCDVTTTC	Misc Kulakovskiy et al.(2013) IRF9_MOUSE.H11MO.0.C	0.788	0.788
For this family, TFs with SR scores > 0.700* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
ENSBTAP00000044267-D1	IRF	46	150	KLRNWVVEQVESGQFPGVCWEDAAKTMFRIPWKHAGKQDFREDQDAAFFKAWAIYKGKYREGSSEGPAIWKTRLRCALNKSCEFEEVPEIGHRDGAEPYKVYRLL

Links
Other IRF family TFs
Other *Bos grunniens* TFs

Invalid Input OrderBy

37 Related TFs

Name	Species	Gene ID	Motif Evidence	SR Score	Action