TF Information

GLYMA02G27230 *(Glycine max)* LOB
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source	Animal TF db
PF03195 (DUF260)	IPR004883	GLYMA02G27230	T245177_2.00	Ensembl (2018-Dec-8)	Link out
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
LBD18 M06962_2.00	Arabidopsis thaliana	SCGGRRAWHVHGSMRNNDN	NHNNYKSCDBDWTYYCCGS	Dap-seq OMalley et al.(2016) LBD18_col_a	0.727	0.727
LBD18 M06963_2.00	Arabidopsis thaliana	CDBDWTTTMHGSHRN	NYDSCDKAAAWHVHG	Dap-seq OMalley et al.(2016) LBD18_colamp_a	0.727	0.727
For this family, TFs with SR scores > 0.700* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
GLYMA02G27230.1	LOB	45	144	PCGACKFLRRRCVEGCIFAPHFGTDQGAAKFAAVHKVFGASNVSKLLSNIPVNRRNEASTTISYEAQARLSDPVYGCVSTILALQQQVATLQAELAMLQT

Links
Other LOB family TFs
Other *Glycine max* TFs

Invalid Input OrderBy

213 Related TFs

Name	Species	Gene ID	Motif Evidence	SR Score	Action