TF Information

GRMZM2G025989 *(Zea mays)* LOB
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source	Animal TF db
PF03195 (DUF260)	IPR004883	GRMZM2G025989	T245267_2.00	Ensembl (2018-Dec-8)	Link out
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
LBD4 M02261_2.00	Arabidopsis thaliana	VDNVCGSNNN	NNNSCGBNHB	PBM Weirauch et al.(2014) pTH7515	0.787	0.787
gw1.238.28.1 M02262_2.00	Physcomitrella patens	NNNNNVNGSN	NSCNBNNNNN	PBM Weirauch et al.(2014) pTH8459	0.787	0.787
LBD6 M06955_2.00	Arabidopsis thaliana	CGSCGGNDDHDRCGGMGRHDN	NHDYCKCCGYHDHHNCCGSCG	Dap-seq OMalley et al.(2016) AS2_col_a	0.713	0.713
LOB M06966_2.00	Arabidopsis thaliana	NVCGGCGGHRRHDRMGGMGGH	DCCKCCKYHDYYDCCGCCGBN	Dap-seq OMalley et al.(2016) LOB_col_a	0.713	0.713
For this family, TFs with SR scores > 0.700* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
GRMZM2G025989_P01	LOB	10	103	PCASCKLLRRRCTQECVFAPYFPPDDPHKFAIVHKVFGASNVSKMLQQRADAVSSLVYEANARMRDPVYGCVGAISYLQQQVSQLQVQLALAKA

Links
Other LOB family TFs
Other *Zea mays* TFs

Invalid Input OrderBy

394 Related TFs

Name	Species	Gene ID	Motif Evidence	SR Score	Action