TF Information

gw1.7.209.1 *(Physcomitrella patens)* LOB
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source
PF03195 (DUF260)	IPR004883	gw1.7.209.1	T246566_2.00	JGI (2012-Mar-17)
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
gw1.238.28.1 M02262_2.00	Physcomitrella patens	NNNNNVNGSN	NSCNBNNNNN	PBM Weirauch et al.(2014) pTH8459	0.724	0.724
LBD6 M06955_2.00	Arabidopsis thaliana	CGSCGGNDDHDRCGGMGRHDN	NHDYCKCCGYHDHHNCCGSCG	Dap-seq OMalley et al.(2016) AS2_col_a	0.713	0.713
LOB M06966_2.00	Arabidopsis thaliana	NVCGGCGGHRRHDRMGGMGGH	DCCKCCKYHDYYDCCGCCGBN	Dap-seq OMalley et al.(2016) LOB_col_a	0.701	0.701
For this family, TFs with SR scores > 0.700* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
gw1.7.209.1	LOB	2	88	ACAACRVLRRKCTAQCLFAPYFPPDQPQKFSHVHKVFGVANVTKMLHDLPPPHREDCVNSLAYEADARVQDPVYGCVGAISILQQQV

Links
Other LOB family TFs
Other *Physcomitrella patens* TFs

Invalid Input OrderBy

102 Related TFs

Name	Species	Gene ID	Motif Evidence	SR Score	Action