TF Information

GSMUA_Achr1G27460_001 *(Musa acuminata)* MADF
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source	Animal TF db
PF10545 (MADF_DNA_bdg)	IPR006578	GSMUA_Achr1G27460_001	T249159_2.00	Ensembl (2018-Dec-8)	Link out
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
AT3G58630 M06976_2.00	Arabidopsis thaliana	HNTCGCCGGARWHDN	NHDWYTCCGGCGAND	Dap-seq OMalley et al.(2016) AT3G58630_col_a	0.901	0.700
AT3G58630 M06977_2.00	Arabidopsis thaliana	NNTCGCCGGARWHDN	NHDWYTCCGGCGANN	Dap-seq OMalley et al.(2016) AT3G58630_colamp_a	0.901	0.700
ASIL2 M06973_2.00	Arabidopsis thaliana	TCRCCGGARAH	DTYTCCGGYGA	Dap-seq OMalley et al.(2016) At3g14180_col	0.853	0.629
For this family, TFs with SR scores > 0.812* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
GSMUA_Achr1P27460_001	MADF	34	111	AWGDRYIELNRGNLRQKHWQEVADAVNSRRGAGRRPPRTDIQCKNRIDTLKKKHKVEKARIAARAESQWPFFSRLDAL

Links
Other MADF family TFs
Other *Musa acuminata* TFs

Invalid Input OrderBy

109 Related TFs

Name	Species	Gene ID	Motif Evidence	SR Score	Action