TF Information

F775_18161 *(Aegilops tauschii)* MADS box
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source	Animal TF db
PF00319 (SRF-TF)	IPR002100	F775_18161	T253929_2.00	Ensembl (2018-Dec-8)	Link out
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
Q9AR49_MAIZE M10980_2.00	Zea mays	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$M29_01	0.729	0.729
AGL16 M06987_2.00	Arabidopsis thaliana	TWCCHAAWDDGGWAA	TTWCCHHWTTDGGWA	Dap-seq OMalley et al.(2016) AGL16_col_a	0.708	0.708
AGL16 M06988_2.00	Arabidopsis thaliana	WDWNTTWCCHWAWWDGGAAAS	STTTCCHWWTWDGGWAANWHW	Dap-seq OMalley et al.(2016) AGL16_colamp_a	0.708	0.708
For this family, TFs with SR scores > 0.700* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
EMT10914	MADS box	41	88	KIENTTSRQVTFSKRKGGLFKKARELGVLCDAQVGVLLFSNTGRLYDY

Links
Other MADS box family TFs
Other *Aegilops tauschii* TFs

Invalid Input OrderBy

184 Related TFs

Name	Species	Gene ID	Motif Evidence	SR Score	Action